Major Pollen Allergen Art v 1, Recombinant, Artemisia Vulgaris, aa25-132, His-Sumo-Tag

Product Overview

• Article Name: Major Pollen Allergen Art v 1, Recombinant, Artemisia Vulgaris, aa25-132, His-Sumo-Tag
• Biozol Catalog Number: USB-517998
• Supplier Catalog Number: 517998
• Alternative Catalog Number: USB-517998-20,USB-517998-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Causes an allergic reaction in human. Binds to IgE of mugwort pollen-sensitized patients (PubMed:12475905, PubMed:14510717, PubMed:20696401). Post-translational modifications might be important in the formation of epitopes recognized by IgE antibodies from allergic patients. Source: Recombinant protein corresponding to aa25-132 of Artemisia Vulgaris Major Pollen Allergen Art v 1, fused to 6xHis-Sumo-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~26.8kD Amino Acid Sequence: AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPPVDGGSPPPPSTH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 26.8
• UniProt: Q84ZX5
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.