Outer Membrane Protein A, Recombinant, E. coli O157:H7, aa164-346, His-Sumo-Tag (OmpA)

Product Overview

• Article Name: Outer Membrane Protein A, Recombinant, E. coli O157:H7, aa164-346, His-Sumo-Tag (OmpA)
• Biozol Catalog Number: USB-518037
• Supplier Catalog Number: 518037
• Alternative Catalog Number: USB-518037-20,USB-518037-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Required for the action of colicins K and L and for the stabilization of mating aggregates in conjugation. Serves as a receptor for a number of T-even like phages. Also acts as a porin with low permeability that allows slow penetration of small solutes. Source: Recombinant protein corresponding to aa164-346 of E. coli O157:H7 Outer Membrane Protein A, fused to 6xHis-Sumo-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~35.6kD Amino Acid Sequence: WTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEVKGIKDVVTQPQA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 35.6
• UniProt: P0A911
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.