Outer Membrane Protein C, Recombinant E. coli, aa22-367, His-Tag (ompC)

Product Overview

• Article Name: Outer Membrane Protein C, Recombinant E. coli, aa22-367, His-Tag (ompC)
• Biozol Catalog Number: USB-518038
• Supplier Catalog Number: 518038
• Alternative Catalog Number: USB-518038-20,USB-518038-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Forms pores that allow passive diffusion of small molecules across the outer membrane. Source: Recombinant protein corresponding to aa22-367 of E. coli Outer Membrane Protein C, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.3kD Amino Acid Sequence: AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 42.3
• UniProt: P06996
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.