Peptidyl-Prolyl Cis-Trans Isomerase A, Recombinant, E. coli O6:H1, aa25-190, His-Sumo-Tag, Myc-Tag (Cyclophilin A, PpiA)
Biozol Catalog Number:
USB-518042
Supplier Catalog Number:
518042
Alternative Catalog Number:
USB-518042-20,USB-518042-100
Manufacturer:
US Biological
Category:
Molekularbiologie
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Source: Recombinant protein corresponding to aa25-190 of E. coli O6:H1 Peptidyl-Prolyl Cis-Trans Isomerase A, fused to 10xHis-Sumo-Tag and N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~38.1kD Amino Acid Sequence: AKGDPHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGFYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQVPTHDVGPYQNVPSKPVVILSAKVLP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted