Scrapie-Responsive Protein 1, Recombinant, Human, aa21-98, His-Tag (SCRG1)

Catalog Number: USB-518100
Article Name: Scrapie-Responsive Protein 1, Recombinant, Human, aa21-98, His-Tag (SCRG1)
Biozol Catalog Number: USB-518100
Supplier Catalog Number: 518100
Alternative Catalog Number: USB-518100-20,USB-518100-100,USB-518100-1
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa21-98 of human Scrapie-Responsive Protein 1, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~12.9kD Amino Acid Sequence: MPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 12.9
UniProt: O75711
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.