Serum Amyloid A Protein, Recombinant, Bovine, aa19-130, His-Sumo-Tag, Myc-Tag (SAA1)

Product Overview

• Article Name: Serum Amyloid A Protein, Recombinant, Bovine, aa19-130, His-Sumo-Tag, Myc-Tag (SAA1)
• Biozol Catalog Number: USB-518110
• Supplier Catalog Number: 518110
• Alternative Catalog Number: USB-518110-20,USB-518110-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Major acute phase reactant. Apolipoprotein of the HDL complex. Source: Recombinant protein corresponding to aa19-130 of bovine Serum Amyloid A Protein, fused to 6xHis-Sumo-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~30.1kD Amino Acid Sequence: QWMSFFGEAYEGAKDMWRAYSDMREANYKGADKYFHARGNYDAAQRGPGGAWAAKVISDARENIQRFTDPLFKGTTSGQGQEDSRADQAANEWGRSGKDPNHFRPAGLPDKY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 30.1
• UniProt: P35541
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.