SH3 and PX Domain-Containing Protein 2A, Recombinant, Human, aa902-986, His-Tag, Myc-Tag (SH3PXD2A, Adapter Protein TKS5, Five SH3 Domain-Containing Protein, SH3 Multiple Domains Protein 1)

Product Overview

• Article Name: SH3 and PX Domain-Containing Protein 2A, Recombinant, Human, aa902-986, His-Tag, Myc-Tag (SH3PXD2A, Adapter Protein TKS5, Five SH3 Domain-Containing Protein, SH3 Multiple Domains Protein 1)
• Biozol Catalog Number: USB-518113
• Supplier Catalog Number: 518113
• Alternative Catalog Number: USB-518113-20,USB-518113-200
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Adapter protein involved in invadopodia and podosome formation, extracellular matrix degradation and invasiveness of some cancer cells. Binds matrix metalloproteinases (ADAMs), NADPH oxidases (NOXs) and phosphoinositides. Acts as an organizer protein that allows NOX1- or NOX3-dependent reactive oxygen species (ROS) generation and ROS localization. In association with ADAM12, mediates the neurotoxic effect of amyloid-beta peptide. Source: Partial recombinant protein corresponding to aa902-986 of human SH3 and PX Domain-Containing Protein 2A, fused to 10xHis-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~14kD AA Sequence: PDPSGKELDTVPAKGRQNEGKSDSLEKIERRVQALNTVNQSKKATPPIPSKPPGGFGKTSGTPAVKMRNGVRQVAVRPQSVFVSP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 14
• UniProt: Q5TCZ1
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.