Human respiratory syncytial virus (HRSV) is the most common etiological agent of acute lower respiratory tract disease in infants and can cause repeated infections throughout life. Human respiratory syncytial virus A (strain Long) major surface glycoprotein G (RSV-G), a member of the pneumoviruses glycoprotein G family, is also known as attachment glycoprotein G and membrane-bound glycoprotein (mG), which contains a linear heparin binding domain essential for virus attachment to the host. Concretely speaking, RSV-G can attache the virion to the host cell membrane by interacting with heparan sulfate, initiating the infection. Furthermore, RSV-G can also interact with host CX3CR1, the receptor for the CX3C chemokine fractalkine, to modulate the immune response and facilitate infection. Unlike the other paramyxovirus attachment proteins, RSV-G lacks both neuraminidase and hemagglutinating activities. Recombinant protein corresponding to His67-Arg297 from human Respiratory Syncytial Virus Glycoprotein G, fused to His-Tag at C-terminal, expressed in HEK293 cells. Swiss/Uniprot Accession: P20895 Molecular Weight: ~26.2kD (predicted) Amino Acid Sequence: HKVTLTTAIIQDATSQIKNTTPTYLTQDPQLGISFSNLSEITSQTTTILA STTPGVKSNLQPTTVKTKNTTTTQTQPSKPTTKQRQNKPPNKPNNDFHFE VFNFVPCSICSNNPTCWAICKRIPNKKPGKKTTTKPTKKPTFKTTKKDHK PQTTKPKEVPTTKPTEEPTINTTKTNIITTLLTNNTTGNPKLTSQMETFH STSSEGNLSPSQVSTTSEHPSQPSSPPNTTR Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder in PBS, pH 7.4. Reconstitute with sterile ddH2O. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing.
* VAT and and shipping costs not included. Errors and price changes excepted