Angiopoietin-2, Recombinant, Human, aa19-496, His-Tag

Catalog Number: USB-532257
Article Name: Angiopoietin-2, Recombinant, Human, aa19-496, His-Tag
Biozol Catalog Number: USB-532257
Supplier Catalog Number: 532257
Alternative Catalog Number: USB-532257-50,USB-532257-100
Manufacturer: US Biological
Category: Molekularbiologie
Angiopoietin-2, also known as ANGPT2, is a member of the ANG family. It has been identified as ligands for vascular endothelial-specific Tie2 receptor tyrosine kinase that interact with ANG2. This protein may be important growth factors in the generation of new blood vessels. Also, it is over-expression disrupts blood vessel formation in the mouse embryo. This protein is strongly expressed only at sites of vascular remodeling. It has been suggested that it may act synergistically with other cytokines such as vascular endothelial growth factor to promote tumor-associated Angiogenesis and tumor progression. Recombinant protein corresponding to aa19-496 from human Angiopoietin-2, fused to His-Tag at C-terminal expressed in CHO cells. Molecular Weight: ~55.7kDa (484aa) Amino Acid Sequence: YNNFRKSMDS IGKKQYQVQH GSCSYTFLLP EMDNCRSSSS PYVSNAVQRD APLEYDDSVQRLQVLENIME NNTQWLMKLE NYIQDNMKKEMVEIQQNAVQ NQTAVMIEIG TNLLNQTAEQTRKLTDVEAQ VLNQTTRLEL QLLEHSLSTN KLEKQILDQT SEINKLQDKNSFLEKKVLAMEDKHIIQLQS IKEEKDQLQV LVSKQNSIIE ELEKKIVTAT VNNSVLQKQQHDLMETVNNL LTMMSTSNSA KDPTVAKEEQ ISFRDCAEVFKSGHTTNGIY TLTFPNSTEEIKAYCDMEAG GGGWTIIQRR EDGSVDFQRT WKEYKVGFGN PSGEYWLGNE FVSQLTNQQR YVLKIHLKDWEGNEAYSLYE HFYLSSEELN YRIHLKGLTG TAGKISSISQ PGNDFSTKDGDNDKCICKCS QMLTGGWWFD ACGPSNLNGM YYPQRQNTNKFNGIKWYYWK GSGYSLKATT MMIRPADFHH HHHH Applications: Suitable for use in SDS-PAGE. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 55.7
NCBI: 001138
UniProt: O15123
Purity: 90% (SDS-PAGE) Endotoxin: 1EU/ug (LAL).
Form: Supplied as a liquid in PBS, pH 7.4, 10% glycerol.