Neprilysin, Recombinant, Human, aa52-750, His-Tag

Catalog Number: USB-532350
Article Name: Neprilysin, Recombinant, Human, aa52-750, His-Tag
Biozol Catalog Number: USB-532350
Supplier Catalog Number: 532350
Alternative Catalog Number: USB-532350-50,USB-532350-100
Manufacturer: US Biological
Category: Molekularbiologie
Neprilysin, also known as MME, is a zinc metallopeptidase expressed at the cell surface of a variety of cells degrades the amyloid beta peptide whose abnormal misfolding and aggregation in neural tissue has been implicated as a cause of Alzheimers disease. It is expressed in a wide variety of tissues and is particularly abundant in kidney. It is also a common acute lymphocytic leukemia antigen that is an important cell surface marker in the diagnosis of human acute lymphocytic leukemia (ALL). It is of use in hematological diagnosis since it is expressed by early B, pro-B and pre-B lymphocytes, and by lymph node germinal centers. Recombinant protein corresponding to aa52-750 from human Neprilysin fused to His-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~80.9kD (708aa) Biological Activity: Specific activity is > 5,000 pmol/min/ug in which one unit will convert 1.0 pmole of Mca-SEVNLDAEFRK(Dnp)RR-NH2 to MCA- Pro-Leu-OH per minute at pH 8.8 at 25C. Amino Acid Sequence: ADPYDDGICK SSDCIKSAAR LIQNMDATTE PCTDFFKYAC GGWLKRNVIPETSSRYGNFDILRDELEVVL KDVLQEPKTE DIVAVQKAKA LYRSCINESA IDSRGGEPLLKLLPDIYGWPVATENWEQKY GASWTAEKAI AQLNSKYGKK VLINLFVGTD DKNSVNHVIHIDQPRLGLPSRDYYECTGIY KEACTAYVDF MISVARLIRQ EERLPIDENQ LALEMNKVMELEKEIANATAKPEDRNDPML LYNKMTLAQI QNNFSLEING KPFSWLNFTN EIMSTVNISITNEEDVVVYAPEYLTKLKPI LTKYSARDLQ NLMSWRFIMD LVSSLSRTYK ESRNAFRKALYGTTSETATWRRCANYVNGN MENAVGRLYV EAAFAGESKH VVEDLIAQIR EVFIQTLDDLTWMDAETKKRAEEKALAIKE RIGYPDDIVS NDNKLNNEYL ELNYKEDEYF ENIIQNLKFSQSKQLKKLREKVDKDEWISG AAVVNAFYSS GRNQIVFPAG ILQPPFFSAQ QSNSLNYGGIGMVIGHEITHGFDDNGRNFN KDGDLVDWWT QQSASNFKEQ SQCMVYQYGN FSWDLAGGQHLNGINTLGENIADNGGLGQA YRAYQNYIKK NGEEKLLPGL DLNHKQLFFL NFAQVWCGTYRPEYAVNSIKTDVHSPGNFR IIGTLQNSAE FSEAFHCRKN SYMNPEKKCR VWHHHHHH Applications: Suitable for use in Enzyme Activity and SDS-PAGE. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 80.9
NCBI: 000893
UniProt: P08473
Purity: 95% (SDS-PAGE) Endotoxin: 1EU/ug (LAL).
Form: Supplied as a liquid in 20mM Tris-HCl, pH 8.0, 100mM sodium chloride, 10% glycerol.