14-3-3 protein zeta/delta, Recombinant, Human, aa1-245, His-Tag

Product Overview

• Article Name: 14-3-3 protein zeta/delta, Recombinant, Human, aa1-245, His-Tag
• Biozol Catalog Number: USB-583362
• Supplier Catalog Number: 583362
• Alternative Catalog Number: USB-583362-20
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Induces ARHGEF7 activity on RAC1 as well as lamellipodia and membrane ruffle formation. In neurons, regulates spine maturation through the modulation of ARHGEF7 activity. Source: Recombinant protein corresponding to aa1-245 from human 14-3-3 protein zeta/delta, fused to 6X His-Tag at C-terminal, expressed in Yeast. Molecular Weight: ~20.6kD Amino Acid Sequence: AEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 20.6
• UniProt: P63104
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.