14-3-3 Protein Zeta/delta, Recombinant, Human, aa133-212, His-GST-Tag

Catalog Number: USB-583363
Article Name: 14-3-3 Protein Zeta/delta, Recombinant, Human, aa133-212, His-GST-Tag
Biozol Catalog Number: USB-583363
Supplier Catalog Number: 583363
Alternative Catalog Number: USB-583363-20,USB-583363-100
Manufacturer: US Biological
Category: Molekularbiologie
Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Partial recombinant protein corresponding to aa133-212 from human 14-3-3 protein zeta/delta, fused to 6X His-GST-Tag at N-terminal, expressed in E.coli. Accession/Uniprot: P63104 Molecular Weight: ~40.6kD Amino Acid Sequence: AAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 40.6
UniProt: P63104
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.