17kD Surface Antigen, Recombinant, Rickettsia rickettsii, aa20-159, His-Tag, Myc-Tag

Catalog Number: USB-583375
Article Name: 17kD Surface Antigen, Recombinant, Rickettsia rickettsii, aa20-159, His-Tag, Myc-Tag
Biozol Catalog Number: USB-583375
Supplier Catalog Number: 583375
Alternative Catalog Number: USB-583375-20,USB-583375-100,USB-583375-1
Manufacturer: US Biological
Category: Molekularbiologie
Recombinant protein corresponding to aa20-159 from Rickettsia rickettsii 17kD surface antigen, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Unprot/Accession: P0A3N5 Molecular Weight: ~21.5kD Amino Acid Sequence: CNGPGGMNKQGTGTLLGGAGGALLGSQFGKGKGQLVGVGVGALLGAVLGGQIGAGMDEQDRRLAELTSQRALETAPSGSNVEWRNPDNGNYGYVTPNKTYRNSTGQYCREYTQTVVIGGKQQKAYGNACRQPDGQWQVVN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 21.9
UniProt: P0A3N5
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.