Full-length recombinant protein corresponding to aa20-159 from Rickettsia rickettsii 17kD surface antigen, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Baculovirus. Swiss/Uniprot: P0A3N5 Molecular Weight: ~18.4kD Amino Acid Sequence: CNGPGGMNKQGTGTLLGGAGGALLGSQFGKGKGQLVGVGVGALLGAVLGGQIGAGMDEQDRRLAELTSQRALETAPSGSNVEWRNPDNGNYGYVTPNKTYRNSTGQYCREYTQTVVIGGKQQKAYGNACRQPDGQWQVVN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
