2-hydroxymuconate Tautomerase, Recombinant, Pseudomonas putida, aa2-63, His-Tag

Catalog Number: USB-583381
Article Name: 2-hydroxymuconate Tautomerase, Recombinant, Pseudomonas putida, aa2-63, His-Tag
Biozol Catalog Number: USB-583381
Supplier Catalog Number: 583381
Alternative Catalog Number: USB-583381-20,USB-583381-100
Manufacturer: US Biological
Category: Molekularbiologie
Catalyzes the ketonization of 2-hydroxymuconate stereoselectively to yield 2-oxo-3-hexenedioate. Source: Recombinant protein corresponding to aa2-63 from Pseudomonas putida 2-hydroxymuconate tautomerase, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~10.9kD Amino Acid Sequence: PFAQIYMIEGRTEAQKKAVIEKVSQALVEATGAPMANVRVWIQEVPKENWGIAGVSAKELGR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 10.9
UniProt: Q93JW0
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.