23.6kD Heat Shock Protein, Recombinant, Arabidopsis thaliana, aa32-210, His-Tag, mitochondrial

Catalog Number: USB-583383
Article Name: 23.6kD Heat Shock Protein, Recombinant, Arabidopsis thaliana, aa32-210, His-Tag, mitochondrial
Biozol Catalog Number: USB-583383
Supplier Catalog Number: 583383
Alternative Catalog Number: USB-583383-20, USB-583383-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa32-210 from Arabidopsis thaliana 23.6kD heat shock protein, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~24.4kD Amino Acid Sequence: FNTNAVRSYDDDGENGDGVDLYRRSVPRRRGDFFSDVFDPFSPTRSVSQVLNLMDQFMENPLLSATRGMGASGARRGWDIKEKDDALYLRIDMPGLSREDVKLALEQDTLVIRGEGKNEEDGGEEGESGNRRFTSRIGLPDKIYKIDEIKAEMKNGVLKVVIPKMKEQERNDVRQIEIN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 24.4
UniProt: Q96331
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.