26S proteasome Non-ATPase Regulatory Subunit 14, Recombinant, Human, aa1-310, MBP-Tag, His-Tag

Catalog Number: USB-583386
Article Name: 26S proteasome Non-ATPase Regulatory Subunit 14, Recombinant, Human, aa1-310, MBP-Tag, His-Tag
Biozol Catalog Number: USB-583386
Supplier Catalog Number: 583386
Alternative Catalog Number: USB-583386-20
Manufacturer: US Biological
Category: Molekularbiologie
Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair. The PSMD14 subunit is a metalloprotease that specifically cleaves Lys-63-linked polyubiquitin chains within the complex. Plays a role in response to double-strand breaks (DSBs). Source: Recombinant protein corresponding to aa1-310 from human 26S proteasome non-ATPase regulatory subunit 14, fused to MBP-Tag at N-terminal and 6X His-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~79.2kD Amino Acid Sequence: MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 79.2
UniProt: O00487
Purity: 85% (SDS-PAGE)
Form: Supplied as a liquid in Tris, 50% glycerol