2S Albumin Imported, Recombinant, Corylus avellana, aa23-147, His-SUMO-Tag

Product Overview

• Article Name: 2S Albumin Imported, Recombinant, Corylus avellana, aa23-147, His-SUMO-Tag
• Biozol Catalog Number: USB-583389
• Supplier Catalog Number: 583389
• Alternative Catalog Number: USB-583389-20,USB-583389-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa23-147 from Corylus avellana 2S albuminImported, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~30.9kD Amino Acid Sequence: FRTTITTVDVDEDIVNQQGRRGESCREQAQRQQNLNQCQRYMRQQSQYGSYDGSNQQQQQELEQCCQQLRQMDERCRCEGLRQAVMQQQGEMRGEEMREVMETARDLPNQCRLSPQRCEIRSARF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 30.9
• UniProt: D0PWG2
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.