3-methyl-2-oxobutanoate hydroxymethyltransferase, Recombinant, Saccharomyces cerevisiae, aa1-312, His-Tag

Catalog Number: USB-583394
Article Name: 3-methyl-2-oxobutanoate hydroxymethyltransferase, Recombinant, Saccharomyces cerevisiae, aa1-312, His-Tag
Biozol Catalog Number: USB-583394
Supplier Catalog Number: 583394
Alternative Catalog Number: USB-583394-20,USB-583394-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa1-312 from Saccharomyces cerevisiae 3-methyl-2-oxobutanoate hydroxymethyltransferase, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~38.5kD Amino Acid Sequence: MNIMKRQLCTSSKRFFSTAKNVVKYNTIQDIRNKYFTGTPLSMCTAYDFITATWVNKANCDLLLVGDSLAMTSLGYDSTITLSLNEFKYHVASVCRAEGSSMVVVDMPFGTFESGISDGLKNAIDIMKLDSKVTSVKVEVGSYTKDKYAMKFIEELCSRGIPVMAHIGLTPQKVHSLGGYKVQGSKSLLQMQELYETAMQLQKIGCWSILIECVPHKMAQFITSKLSVPTIGIGAGNGTSGQVLVISDLLGMQGDSVPKFVKQAVNMTDIATQGLKEYIASVEDRTFPERGTHTFKVKEDLWNEFLSSINEK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 38.5
UniProt: P38122
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.