30S Ribosomal Protein S2, Recombinant, E. coli, aa2-241, GST-Tag

Catalog Number: USB-583412
Article Name: 30S Ribosomal Protein S2, Recombinant, E. coli, aa2-241, GST-Tag
Biozol Catalog Number: USB-583412
Supplier Catalog Number: 583412
Alternative Catalog Number: USB-583412-20, USB-583412-100
Manufacturer: US Biological
Category: Molekularbiologie
Required for ribosomal protein S1 to bind to the 30S subunit. Source: Recombinant protein corresponding to aa2-241 from Escherichia coli 30S ribosomal protein S2, fused to GST-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~53.6kD Amino Acid Sequence: ATVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEKTVPMFNEALAELNKIASRKGKILFVGTKRAASEAVKDAALSCDQFFVNHRWLGGMLTNWKTVRQSIKRLKDLETQSQDGTFDKLTKKEALMRTRELEKLENSLGGIKDMGGLPDALFVIDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAIRAVTLYLGAVAATVREGRSQDLASQAEESFVEAE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 53.6
UniProt: P0A7V0
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.