40S Ribosomal Protein S3, Recombinant, Drosophila melanogaster, aa1-246, His-Tag

Catalog Number: USB-583420
Article Name: 40S Ribosomal Protein S3, Recombinant, Drosophila melanogaster, aa1-246, His-Tag
Biozol Catalog Number: USB-583420
Supplier Catalog Number: 583420
Alternative Catalog Number: USB-583420-20,USB-583420-100
Manufacturer: US Biological
Category: Molekularbiologie
Has DNA repair activity directed towards the mutagenic lesions 8-oxoguanine and abasic sites in DNA. It can cleave DNA containing 8-oxoguanine residues efficiently. Also acts as an ap lyase, cleaving phosphodiester bonds via a beta,delta elimination reaction. Source: Recombinant protein corresponding to aa1-246 from Drosophila melanogaster 40S ribosomal protein S3, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~31.5kD Amino Acid Sequence: MNANLPISKKRKFVSDGIFKAELNEFLTRELAEDGYSGVEVRVTPSRTEIIIMATKTQQVLGEKGRRIRELTAMVQKRFNFETGRIELYAEKVAARGLCAIAQAESLRYKLTGGLAVRRACYGVLRYIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPCNDYVETATRHVLLRQGVLGIKVKVMLPYDPKNKIGPKKPLPDNVSVVEPKEEKIYETPETEYKIPPPSKPLDDLSEAKVL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 31.5
UniProt: Q06559
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.