4b Internalin-A, Recombinant, Listeria monocytogenes serotype, aa562-770, His-SUMO-Tag

Catalog Number: USB-583428
Article Name: 4b Internalin-A, Recombinant, Listeria monocytogenes serotype, aa562-770, His-SUMO-Tag
Biozol Catalog Number: USB-583428
Supplier Catalog Number: 583428
Alternative Catalog Number: USB-583428-20, USB-583428-100
Manufacturer: US Biological
Category: Molekularbiologie
Mediates the entry of Listeria monocytogenes into cells. Binds to host receptor cadherin-1 (E-cadherin, CDH1). Source: Recombinant protein corresponding to aa562-770 from Listeria monocytogenes serotype 4b Internalin-A, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~38.5kD Amino Acid Sequence: QFSINSYTATFDNDGVTTSQTVDYQGLLQEPTAPTKEGYTFKGWYDAKTGGDKWDFATSKMPAKNITLYAQYSANSYTATFDVDGKTTTQAVDYQGLLKEPKTPTKAGYTFKGWYDEKTDGKKWDFATDKMPANDITLYAQFTKNPVAPPTTGGNTPPTTNNGGNTTPPSANIPGSNTSNTSTGNSASTTSTMNAYDPYNSKEASLPTT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 38.5
UniProt: Q723K6
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.