50S Ribosomal Protein L22, Recombinant, Anaplasma phagocytophilum, aa1-112, His-SUMO-Tag, Myc-Tag
Biozol Catalog Number:
USB-583446
Supplier Catalog Number:
583446
Alternative Catalog Number:
USB-583446-20,USB-583446-100
Manufacturer:
US Biological
Category:
Molekularbiologie
This protein binds specifically to 23S rRNA, its binding is stimulated by other ribosomal proteins, e.g. L4, L17, and L20. It is important during the early stages of 50S assembly. It makes multiple contacts with different domains of the 23S rRNA in the assembled 50S subunit and ribosome (By similarity). Source: Recombinant protein corresponding to aa1-112 from anaplasma phagocytophilum 50S ribosomal protein L22, fused to 10X His-SUMO-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~32.2kD Amino Acid Sequence: MSIVIAAKGLGLRSTPAKLNLVADLIRGKDVAVAAMYLKFCKKKAALLIDKVLKSAIANARANYGVDADNLYVKEVLVGKAFTLRRVQPRARGRACRISKRYGSVVVKLLER Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted