60S Acidic Ribosomal Protein P2, Recombinant, Human, aa1-115, His-Tag

Product Overview

• Article Name: 60S Acidic Ribosomal Protein P2, Recombinant, Human, aa1-115, His-Tag
• Biozol Catalog Number: USB-583451
• Supplier Catalog Number: 583451
• Alternative Catalog Number: USB-583451-20,USB-583451-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Plays an important role in the elongation step of protein synthesis. Source: Recombinant protein corresponding to aa1-115 from human 60S acidic ribosomal protein P2, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~15.7kD Amino Acid Sequence: MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 15.7
• UniProt: P05387
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.