7-alpha-hydroxysteroid Dehydrogenase, Recombinant, E. coli O157:H7, aa1-255, His-Tag, Myc-Tag
Biozol Catalog Number:
USB-583454
Supplier Catalog Number:
583454
Alternative Catalog Number:
USB-583454-20,USB-583454-100
Manufacturer:
US Biological
Category:
Molekularbiologie
7alpha-hydroxysteroid dehydrogenase involved in the metabolism of bile acids. Catalyzes the NAD(+)-dependent oxidation of the 7alpha-hydroxy group of 7alpha-hydroxysteroids, such as the major human bile acids cholate and chenodeoxycholate, to the corresponding 7-oxosteroids. To a lesser extent, can also act on taurochenodeoxycholate, taurocholate and glycocholate. Can also use glycochenodeoxycholate as substrate. Is not able to use NADP(+) instead of NAD(+) as the electron acceptor. Source: Recombinant protein corresponding to aa1-255 from Escherichia coli O157:H7 7-alpha-hydroxysteroid dehydrogenase, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~34.2kD Amino Acid Sequence: MFNSDNLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPFDMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGVQELN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted