7, 8-dihydro-8-oxoguanine Triphosphatase, Recombinant, Human, aa19-197

Catalog Number: USB-583455
Article Name: 7, 8-dihydro-8-oxoguanine Triphosphatase, Recombinant, Human, aa19-197
Biozol Catalog Number: USB-583455
Supplier Catalog Number: 583455
Alternative Catalog Number: USB-583455-20,USB-583455-100
Manufacturer: US Biological
Category: Molekularbiologie
Antimutagenic. Acts as a sanitizing enzyme for oxidized nucleotide pools, thus suppressing cell dysfunction and death induced by oxidative stress. Hydrolyzes 8-oxo-dGTP, 8-oxo-dATP and 2-OH-dATP, thus preventing misincorporation of oxidized purine nucleoside triphosphates into DNA and subsequently preventing A. Recombinant protein corresponding to aa19-197 from human 7,8-dihydro-8-oxoguanine triphosphatase, expressed in E.coli. Uniprot/Swiss Accession: P36639 Molecular Weight: ~20.3kD Amino Acid Sequence: MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 20.3
UniProt: P36639
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.