7, 8-dihydro-8-oxoguanine Triphosphatase, Recombinant, Human, aa19-197, His-Tag

Catalog Number: USB-583457
Article Name: 7, 8-dihydro-8-oxoguanine Triphosphatase, Recombinant, Human, aa19-197, His-Tag
Biozol Catalog Number: USB-583457
Supplier Catalog Number: 583457
Alternative Catalog Number: USB-583457-20,USB-583457-100
Manufacturer: US Biological
Category: Molekularbiologie
Oxidized purine nucleoside triphosphate hydrolase which is a prominent sanitizer of the oxidized nucleotide pool. Catalyzes the hydrolysis of 2-oxo-dATP (2-hydroxy-dATP) into 2-oxo-dAMP. Has also a significant hydrolase activity toward 2-oxo-ATP, 8-oxo-dGTP and 8-oxo-dATP. Through the hydrolysis of oxidized purine nucleoside triphosphates, prevents their incorporation into DNA and the subsequent transversions A:T to C:G and G:C to T:A. Also catalyzes the hydrolysis of methylated purine nucleoside triphosphate preventing their integration into DNA. Through this antimutagenic activity protects cells from oxidative stress. Recombinant protein corresponding to aa19-197 from human 7,8-dihydro-8-oxoguanine triphosphatase, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~22.3kD Amino Acid Sequence: MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 22.3
UniProt: P36639
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.