A Disintegrin and Metalloproteinase with Thrombospondin Motifs 18, Recombinant, Human, aa942-1047, His-Tag

Catalog Number: USB-583459
Article Name: A Disintegrin and Metalloproteinase with Thrombospondin Motifs 18, Recombinant, Human, aa942-1047, His-Tag
Biozol Catalog Number: USB-583459
Supplier Catalog Number: 583459
Alternative Catalog Number: USB-583459-20, USB-583459-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa942-1047 from human A disintegrin and metalloproteinase with thrombospondin motifs 18, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~15.5kD Amino Acid Sequence: TCSKACAGGQQSRKIQCVQKKPFQKEEAVLHSLCPVSTPTQVQACNSHACPPQWSLGPWSQCSKTCGRGVRKRELLCKGSAAETLPESQCTSLPRPELQEGCVLGR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 15.5
UniProt: Q8TE60
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.