A Disintegrin and Metalloproteinase with Thrombospondin Motifs 4, Recombinant, Human, aa213-319, GST-Tag

Product Overview

• Article Name: A Disintegrin and Metalloproteinase with Thrombospondin Motifs 4, Recombinant, Human, aa213-319, GST-Tag
• Biozol Catalog Number: USB-583461
• Supplier Catalog Number: 583461
• Alternative Catalog Number: USB-583461-20, USB-583461-100, USB-583461-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Cleaves aggrecan, a cartilage proteoglycan, and may be involved in its turnover. May play an important role in the destruction of aggrecan in arthritic diseases. Could also be a critical factor in the exacerbation of neurodegeneration in Alzheimer disease. Cleaves aggrecan at the 392-Glu-|-Ala-393 site. Source: Recombinant protein corresponding to aa213-319 from human A disintegrin and metalloproteinase with thrombospondin motifs 4, fused to GST-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~39.0kD Amino Acid Sequence: FASLSRFVETLVVADDKMAAFHGAGLKRYLLTVMAAAAKAFKHPSIRNPVSLVVTRLVILGSGEEGPQVGPSAAQTLRSFCAWQRGLNTPEDSDPDHFDTAILFTRQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 39
• UniProt: O75173
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.