A Major Surface Glycoprotein G, Recombinant, Human Respiratory Syncytial Virus, aa67-298, His-SUMO-Tag

Catalog Number: USB-583463
Article Name: A Major Surface Glycoprotein G, Recombinant, Human Respiratory Syncytial Virus, aa67-298, His-SUMO-Tag
Biozol Catalog Number: USB-583463
Supplier Catalog Number: 583463
Alternative Catalog Number: USB-583463-20,USB-583463-100
Manufacturer: US Biological
Category: Molekularbiologie
Attaches the virion to the host cell membrane by interacting with heparan sulfate, initiating the infection. Interacts with host CX3CR1, the receptor for the CX3C chemokine fractalkine, to modulate the immune response and facilitate infection. Unlike the other paramyxovirus attachment proteins, lacks both neuraminidase and hemagglutinating activities (Probable)., Helps the virus escape antibody-dependent restriction of replication by acting as an antigen decoy and by modulating the activity of leukocytes bearing Fc-gamma receptors. Source: Recombinant protein corresponding to aa67-298 from Human respiratory syncytial virus A Major surface glycoprotein G, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~41.3kD Amino Acid Sequence: HKVTPTTAIIQDATSQIKNTTPTYLTQNPQLGISPSNPSEITSQITTILASTTPGVKSTLQSTTVKTKNTTTTQTQPSKPTTKQRQNKPPSKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKKTTTKPTKKPTLKTTKKDPKPQTTKSKEVPTTKPTEEPTINTTKTNIITTLLTSNTTGNPELTSQMETFHSTSSEGNPSPSQVSTTSEYPSQPSSPPNTPRQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 41.3
UniProt: P03423
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.