Abrin-a, Recombinant, Abrus precatorius, aa1-251, His-Tag

Catalog Number: USB-583467
Article Name: Abrin-a, Recombinant, Abrus precatorius, aa1-251, His-Tag
Biozol Catalog Number: USB-583467
Supplier Catalog Number: 583467
Alternative Catalog Number: USB-583467-20,USB-583467-100
Manufacturer: US Biological
Category: Molekularbiologie
The A chain is responsible for inhibiting protein synthesis through the catalytic inactivation of 60S ribosomal subunits by removing adenine from position 4,324 of 28S rRNA. Abrin-a is more toxic than ricin., The B chain is a galactose-specific lectin that facilitates the binding of abrin to the cell membrane that precedes endocytosis. Source: Recombinant protein corresponding to aa1-251 from Abrus precatorius Abrin-a, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~30.1kD Amino Acid Sequence: QDRPIKFSTEGATSQSYKQFIEALRERLRGGLIHDIPVLPDPTTLQERNRYITVELSNSDTESIEVGIDVTNAYVVAYRAGTQSYFLRDAPSSASDYLFTGTDQHSLPFYGTYGDLERWAHQSRQQIPLGLQALTHGISFFRSGGNDNEEKARTLIVIIQMVAEAARFRYISNRVRVSIQTGTAFQPDAAMISLENNWDNLSRGVQESVQDTFPNQVTLTNIRNEPVIVDSLSHPTVAVLALMLFVCNPPN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 30.1
UniProt: P11140
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.