Acetylcholine Receptor Subunit Alpha, Recombinant, Torpedo californica, aa25-234, His-SUMOSTAR-Tag

Catalog Number: USB-583482
Article Name: Acetylcholine Receptor Subunit Alpha, Recombinant, Torpedo californica, aa25-234, His-SUMOSTAR-Tag
Biozol Catalog Number: USB-583482
Supplier Catalog Number: 583482
Alternative Catalog Number: USB-583482-20,USB-583482-100
Manufacturer: US Biological
Category: Molekularbiologie
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. Source: Recombinant protein corresponding to aa25-234 from Torpedo californica Acetylcholine receptor subunit alpha, fused to 6X His-SUMOSTAR-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~37.9kD Amino Acid Sequence: SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 37.9
UniProt: P02710
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.