Acid Ceramidase, Recombinant, Mouse, aa19-141, His-SUMO-Tag, Myc-Tag

Catalog Number: USB-583487
Article Name: Acid Ceramidase, Recombinant, Mouse, aa19-141, His-SUMO-Tag, Myc-Tag
Biozol Catalog Number: USB-583487
Supplier Catalog Number: 583487
Alternative Catalog Number: USB-583487-20,USB-583487-100
Manufacturer: US Biological
Category: Molekularbiologie
Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid. Source: Recombinant protein corresponding to aa19-141 from Rotavirus A Non-structural glycoprotein 4, fused to 6X His-SUMO-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~33.8kD Amino Acid Sequence: QAQDVPPWTEDCRKSTYPPSGPTYRGPVPWHTINLDLPPYKRWHELLAQKAPALRILVNSITSLVNTFVPSGKLMKMVDQKLPGMIGSLPDPFGEEMRGIADVTGIPLGEIISFNIFYELFTM Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 33.8
UniProt: Q9WV54
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.