Acyl-CoA 6-desaturase, Recombinant, Human, aa1-131, His-SUMO-Tag

Catalog Number: USB-583510
Article Name: Acyl-CoA 6-desaturase, Recombinant, Human, aa1-131, His-SUMO-Tag
Biozol Catalog Number: USB-583510
Supplier Catalog Number: 583510
Alternative Catalog Number: USB-583510-20,USB-583510-100
Manufacturer: US Biological
Category: Molekularbiologie
Component of a lipid metabolic pathway that catalyzes biosynthesis of highly unsaturated fatty acids (HUFA) from precursor essential polyunsaturated fatty acids (PUFA) linoleic acid (LA) (18). Source: Recombinant protein corresponding to aa1-131 from human Acyl-CoA 6-desaturase, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~30.9kD Amino Acid Sequence: MGKGGNQGEGAAEREVSVPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSIQHPGGQRVIGHYAGEDATDAFRAFHPDLEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTAEDMNLFKTNHV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 30.9
UniProt: O95864
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.