ADAM DEC1, Recombinant, Mouse, aa209-467, His-Tag

Catalog Number: USB-583517
Article Name: ADAM DEC1, Recombinant, Mouse, aa209-467, His-Tag
Biozol Catalog Number: USB-583517
Supplier Catalog Number: 583517
Alternative Catalog Number: USB-583517-20,USB-583517-100
Manufacturer: US Biological
Category: Molekularbiologie
May play an important role in the control of the immune response and during pregnancy. Source: Recombinant protein corresponding to aa209-467 from mouse ADAM DEC1, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~34.9kD Amino Acid Sequence: NEDLLQGQKYIGLFLVLDNAYYKLYNGNVTQMRTFLFKVLNLLNMIYKTINIQVSLVGMEIWSDQDKIKVEPNLGATFTHFMRWHYSNLGKRIHNHAQLLSGASFRHGRVGMAAGNSFCTTSSVSVIEAKKKNNVALVALMSHELGHALGMKDVPYYTKCPSGSCVMNQYLSSKFPKDFSTVSRSHFQGFLSSRNARCLLLAPDPKNIIKPTCGNQVLDVGEECDCGSPEECTNLCCEPLTCRLKSQPDCSEASNHITE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 34.9
UniProt: Q9R0X2
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.