Adrenodoxin, Mitochondrial, Recombinant, Bovine, aa59-186, His-Tag

Catalog Number: USB-583531
Article Name: Adrenodoxin, Mitochondrial, Recombinant, Bovine, aa59-186, His-Tag
Biozol Catalog Number: USB-583531
Supplier Catalog Number: 583531
Alternative Catalog Number: USB-583531-20,USB-583531-100
Manufacturer: US Biological
Category: Molekularbiologie
Essential for the synthesis of various steroid hormones. Participates in the reduction of mitochondrial cytochrome P450 for steroidogenesis. Transfers electrons from adrenodoxin reductase to CYP11A1, a cytochrome P450 that catalyzes cholesterol side-chain cleavage to produce pregnenolone, the precursor of most steroid hormones. Does not form a ternary complex with adrenodoxin reductase and CYP11A1 but shuttles between the two enzymes to transfer electrons. Source: Recombinant protein corresponding to aa59-186 from bovine Adrenodoxin, mitochondrial, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~15.3kD Amino Acid Sequence: SSSEDKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVPDAVSDARESIDMGMNSSKIE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 15.3
UniProt: P00257
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.