Agouti-signaling Protein, Recombinant, Bovine, aa23-133, His-Tag

Catalog Number: USB-583534
Article Name: Agouti-signaling Protein, Recombinant, Bovine, aa23-133, His-Tag
Biozol Catalog Number: USB-583534
Supplier Catalog Number: 583534
Alternative Catalog Number: USB-583534-20
Manufacturer: US Biological
Category: Molekularbiologie
Involved in the regulation of melanogenesis. The binding of ASP to MC1R precludes alpha-MSH initiated signaling and thus blocks production of cAMP, leading to a down-regulation of eumelanogenesis (brown/black pigment) and thus increasing synthesis of pheomelanin (yellow/red pigment) (By similarity). Source: Recombinant protein corresponding to bovine Agouti-signaling protein, fused to 10X His-Tag at N-terminal, expressed in Baculovirus. Molecular Weight: ~14.9kD Amino Acid Sequence: HLAPEEKPRDERNLKNNSSMNLLDFPSVSIVALNKKSKKISRNEAEKKKRPSKRKAPMKNVARTRPPPPTPCVATRDSCKPPAPACCDPCAFCQCRFFRSACSCRVLNPTC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 14.9
UniProt: Q29414
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.