Allergen Bla g 4, Recombinant, Blattella germanica, aa13-182, His-Tag

Catalog Number: USB-583554
Article Name: Allergen Bla g 4, Recombinant, Blattella germanica, aa13-182, His-Tag
Biozol Catalog Number: USB-583554
Supplier Catalog Number: 583554
Alternative Catalog Number: USB-583554-20,USB-583554-100
Manufacturer: US Biological
Category: Molekularbiologie
Probable ligand-binding protein. Source: Recombinant protein corresponding to aa13-182 from blattella germanica Allergen Bla g 4, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~21.8kD Amino Acid Sequence: NEDCFRHESLVPNLDYERFRGSWIIAAGTSEALTQYKCWIDRFSYDDALVSKYTDSQGKNRTTIRGRTKFEGNKFTIDYNDKGKAFSAPYSVLATDYENYAIVEGCPAAANGHVIYVQIRFSVRRFHPKLGDKEMIQHYTLDQVNQHKKAIEEDLKHFNLKYEDLHSTCH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 21.8
UniProt: P54962
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.