Alpha-1-acid Glycoprotein, Recombinant, Rat, aa19-205, His-Tag

Catalog Number: USB-583560
Article Name: Alpha-1-acid Glycoprotein, Recombinant, Rat, aa19-205, His-Tag
Biozol Catalog Number: USB-583560
Supplier Catalog Number: 583560
Alternative Catalog Number: USB-583560-20,USB-583560-100
Manufacturer: US Biological
Category: Molekularbiologie
Functions as transport protein in the blood stream. Binds various ligands in the interior of its beta-barrel domain. Appears to function in modulating the activity of the immune system during the acute-phase reaction. Source: Recombinant protein corresponding to aa19-205 from rat Alpha-1-acid glycoprotein, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~25.7kD Amino Acid Sequence: QNPEPANITLGIPITNETLKWLSDKWFYMGAAFRDPVFKQAVQTIQTEYFYLTPNLINDTIELREFQTTDDQCVYNFTHLGVQRENGTLSKCAGAVKIFAHLIVLKKHGTFMLAFNLTDENRGLSFYAKKPDLSPELRKIFQQAVKDVGMDESEIVFVDWTKDKCSEQQKQQLELEKETKKETKKDP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 25.7
UniProt: P02764
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.