Alpha-2-macroglobulin Receptor-associated Protein, Recombinant, Mouse, aa248-360

Catalog Number: USB-583566
Article Name: Alpha-2-macroglobulin Receptor-associated Protein, Recombinant, Mouse, aa248-360
Biozol Catalog Number: USB-583566
Supplier Catalog Number: 583566
Alternative Catalog Number: USB-583566-20, USB-583566-100
Manufacturer: US Biological
Category: Molekularbiologie
Molecular chaperone for LDL receptor-related proteins that may regulate their ligand binding activity along the secretory pathway. Partial recombinant protein corresponding to aa248-360 from mouse Alpha-2-macroglobulin receptor-associated protein, expressed in E.coli. Molecular Weight: ~40.5kD Amino Acid Sequence: MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK+GYGSTTEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKFNFCQKQLEISFQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 40.5
UniProt: P55302
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.