Alpha-crystallin B Chain, Recombinant, Human, aa1-175

Product Overview

• Article Name: Alpha-crystallin B Chain, Recombinant, Human, aa1-175
• Biozol Catalog Number: USB-583575
• Supplier Catalog Number: 583575
• Alternative Catalog Number: USB-583575-20, USB-583575-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

May contribute to the transparency and refractive index of the lens. Has chaperone-like activity, preventing aggregation of various proteins under a wide range of stress conditions. Full length recombinant protein corresponding to aa1-175 from human Alpha-crystallin B chain, expressed in E. coli. Uniprot/Swiss Accession: P02511 Molecular Weight: ~20.2kD Amino Acid Sequence: MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 20.2
• UniProt: P02511
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.