Alpha-ketoglutarate-dependent Dioxygenase AlkB, Recombinant, Escherichia coli, aa1-216, His-SUMO-Tag, Myc-Tag

Catalog Number: USB-583585
Article Name: Alpha-ketoglutarate-dependent Dioxygenase AlkB, Recombinant, Escherichia coli, aa1-216, His-SUMO-Tag, Myc-Tag
Biozol Catalog Number: USB-583585
Supplier Catalog Number: 583585
Alternative Catalog Number: USB-583585-20, USB-583585-100
Manufacturer: US Biological
Category: Molekularbiologie
Dioxygenase that repairs alkylated DNA and RNA containing 3-methylcytosine or 1-methyladenine by oxidative demethylation. Has highest activity towards 3-methylcytosine. Has lower activity towards alkylated DNA containing ethenoadenine, and no detectable activity towards 1-methylguanine or 3-methylthymine. Accepts double-stranded and single-stranded substrates. Requires molecular oxygen, alpha-ketoglutarate and iron. Provides extensive resistance to alkylating agents such as MMS and DMS (SN2 agents), but not to MMNG and MNU (SN1 agents). Source: Recombinant protein corresponding to aa1-216 from Escherichia coli Alpha-ketoglutarate-dependent dioxygenase AlkB, fused to 10X His-SUMO-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~44.1kD Amino Acid Sequence: MLDLFADAEPWQEPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGKKE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 44.1
UniProt: P05050
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.