Alpha-synuclein, Recombinant, Macaca fascicularis, aa1-140, His-SUMO-Tag

Catalog Number: USB-583594
Article Name: Alpha-synuclein, Recombinant, Macaca fascicularis, aa1-140, His-SUMO-Tag
Biozol Catalog Number: USB-583594
Supplier Catalog Number: 583594
Alternative Catalog Number: USB-583594-20,USB-583594-100
Manufacturer: US Biological
Category: Molekularbiologie
May be involved in the regulation of dopamine release and transport. Source: Recombinant protein corresponding to aa1-140 from Macaca fascicularis Alpha-synuclein, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~30.5kD Amino Acid Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFIKKDQLGKNEEGAPQEGILQDMPVDPDNEAYEMPSEEGYQDYEPEA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 30.5
UniProt: P61142
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.