Amelogenin, X Isoform, Recombinant, Human, aa17-191, His-Tag, Myc-Tag

Catalog Number: USB-583606
Article Name: Amelogenin, X Isoform, Recombinant, Human, aa17-191, His-Tag, Myc-Tag
Biozol Catalog Number: USB-583606
Supplier Catalog Number: 583606
Alternative Catalog Number: USB-583606-20,USB-583606-100
Manufacturer: US Biological
Category: Molekularbiologie
Plays a role in biomineralization. Seems to regulate the formation of crystallites during the secretory stage of tooth enamel development. Thought to play a major role in the structural organization and mineralization of developing enamel. Source: Recombinant protein corresponding to aa17-191 from human Amelogenin, X isoform, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~23.8kD Amino Acid Sequence: MPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 23.8
UniProt: Q99217
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.