Amphoterin-induced Protein 3, Recombinant, Rat, aa20-383, His-Tag
Biozol Catalog Number:
USB-583611
Supplier Catalog Number:
583611
Alternative Catalog Number:
USB-583611-20,USB-583611-100
Manufacturer:
US Biological
Category:
Molekularbiologie
May mediate heterophilic cell-cell interaction. May contribute to signal transduction through its intracellular domain. Source: Recombinant protein corresponding to aa20-383 from rat Amphoterin-induced protein 3, fused to 6X His-Tag at N-terminal, expressed in Mammalian cell. Molecular Weight: ~44.4kD Amino Acid Sequence: TSDLEGVLPPDPHNCPNKCVCAADVLSCAGRGLQDLPAALPATAAELDLSHNALKRLHPGWLAPLSRLRALYLGYNKLDVLGRGVFTNASGLRILDLSSNLLRRLRTYDLDGLEELEKLLLFNNRLMHLDLDAFQGLSMLSHLYLSCNELSSFSFNHLHGLGLTRLRTLDLSSNWLGHVSVPELAALPTFLKNRLYLHNNPLPCDCSLYHLLRRWHQRGLSALHDFEREYTCLAFKVAESRVRFFEHSRVFKNCSVAAAPGLELPEEELHTHVGQSLRLFCNTTVPAARVAWVSPKNELLVAPGSQDGSIAVLADGSLAIGRVQEQHAGLFVCLASGPRLHHNQTLEYNVSVHKPRPEPEAFNT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted