Angiogenin, Recombinant, Mouse, aa25-145, His-Tag

Catalog Number: USB-583614
Article Name: Angiogenin, Recombinant, Mouse, aa25-145, His-Tag
Biozol Catalog Number: USB-583614
Supplier Catalog Number: 583614
Alternative Catalog Number: USB-583614-20,USB-583614-100
Manufacturer: US Biological
Category: Molekularbiologie
Binds to actin on the surface of endothelial cells, once bound, angiogenin is endocytosed and translocated to the nucleus. Stimulates ribosomal RNA synthesis including that containing the initiation site sequences of 45S rRNA. Cleaves tRNA within anticodon loops to produce tRNA-derived stress-induced fragments (tiRNAs) which inhibit protein synthesis and triggers the assembly of stress granules (SGs). Angiogenin induces vascularization of normal and malignant tissues. Angiogenic activity is regulated by interaction with RNH1 in vivo. Source: Recombinant protein corresponding to aa25-145 from mouse Angiogenin, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~15.8kD Amino Acid Sequence: QDDSRYTKFLTQHHDAKPKGRDDRYCERMMKRRSLTSPCKDVNTFIHGNKSNIKAICGANGSPYRENLRMSKSPFQVTTCKHTGGSPRPPCQYRASAGFRHVVIACENGLPVHFDESFFSL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 15.8
UniProt: P21570
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.