Anionic Trypsin-1, Recombinant, Rat, aa24-246, His-Tag

Catalog Number: USB-583620
Article Name: Anionic Trypsin-1, Recombinant, Rat, aa24-246, His-Tag
Biozol Catalog Number: USB-583620
Supplier Catalog Number: 583620
Alternative Catalog Number: USB-583620-20,USB-583620-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa24-246 from rat Anionic trypsin-1, fused to 10X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~27.2kD Amino Acid Sequence: IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 27.2
UniProt: P00762
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.