Anterior Gradient Protein 2 Homolog, Recombinant, Mouse, aa21-175, His-Tag, Myc-Tag

Product Overview

• Article Name: Anterior Gradient Protein 2 Homolog, Recombinant, Mouse, aa21-175, His-Tag, Myc-Tag
• Biozol Catalog Number: USB-583632
• Supplier Catalog Number: 583632
• Alternative Catalog Number: USB-583632-20
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Required for MUC2 post-transcriptional synthesis and secretion. May play a role in the production of mucus by intestinal cells. Proto-oncogene that may play a role in cell migration, cell differentiation and cell growth. Promotes cell adhesion. Source: Recombinant protein corresponding to aa21-175 from mouse Anterior gradient protein 2 homolog, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~21.8kD Amino Acid Sequence: KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 21.8
• UniProt: O88312
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.