Antigenic Integral Membrane Glycoprotein, Recombinant, Schistosoma mansoni, aa69-160, His-Trx-Tag

Catalog Number: USB-583636
Article Name: Antigenic Integral Membrane Glycoprotein, Recombinant, Schistosoma mansoni, aa69-160, His-Trx-Tag
Biozol Catalog Number: USB-583636
Supplier Catalog Number: 583636
Alternative Catalog Number: USB-583636-20,USB-583636-100
Manufacturer: US Biological
Category: Molekularbiologie
Major antigen in the surface tegument. Source: Recombinant protein corresponding to aa69-160 from Schistosoma mansoni Antigenic integral membrane glycoprotein, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~28.9kD Amino Acid Sequence: VNSEENSNSIITDEDYDHYNSSLDSSNNVKHSQEAFHRNSDPDGFPEYEFLNETSIEIKEELGQELHQLQLILDELSRRIRATPNSANKYMK Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 28.9
UniProt: P23126
Purity: 85% (SDS-PAGE)
Form: Supplied as a liquid in Tris, pH 8.0, 50% glycerol