Apolipoprotein A-I, Recombinant, Bovine, aa25-265, His-Tag

Catalog Number: USB-583651
Article Name: Apolipoprotein A-I, Recombinant, Bovine, aa25-265, His-Tag
Biozol Catalog Number: USB-583651
Supplier Catalog Number: 583651
Alternative Catalog Number: USB-583651-20,USB-583651-200
Manufacturer: US Biological
Category: Molekularbiologie
Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility. Source: Recombinant protein corresponding to aa25-265 from bovine Apolipoprotein A-I, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~31.6kD Amino Acid Sequence: DDPQSSWDRVKDFATVYVEAIKDSGRDYVAQFEASALGKQLNLKLLDNWDTLASTLSKVREQLGPVTQEFWDNLEKETASLRQEMHKDLEEVKQKVQPYLDEFQKKWHEEVEIYRQKVAPLGEEFREGARQKVQELQDKLSPLAQELRDRARAHVETLRQQLAPYSDDLRQRLTARLEALKEGGGSLAEYHAKASEQLKALGEKAKPVLEDLRQGLLPVLESLKVSILAAIDEASKKLNAQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 31.6
UniProt: P15497
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.